PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 492780
Common NameARALYDRAFT_492780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 181aa    MW: 20167.4 Da    PI: 7.9043
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
492780genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.64.7e-372379561
  zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
             + c+rCds+ntkfCyynnysl qPryfCk+CrryWt+GG+lrnvP+Gg++r ++++
  492780 23 PRVCARCDSDNTKFCYYNNYSLLQPRYFCKNCRRYWTHGGTLRNVPIGGSSRAKQAR 79
            568*************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.8E-312477IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-242477IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.6922478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MDDLNVFANE DNQVNGVKPT PPPRVCARCD SDNTKFCYYN NYSLLQPRYF CKNCRRYWTH  60
GGTLRNVPIG GSSRAKQARV NQPSVARMVP VEIQPVNHQP FLNVQENINF VGPFGASSSS  120
SDAAVGNHFG SLSDIHGGMV TNVHPTRTFR PNHRLAFPDG SFEQDYYDVG SDNLMVNQQV  180
G
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00116ampDAPTransfer from AT4G21040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936900.0AB493690.1 Arabidopsis thaliana At4g21080 gene for hypothetical protein, partial cds, clone: RAAt4g21080.
GenBankAL0219600.0AL021960.2 Arabidopsis thaliana DNA chromosome 4, BAC clone F7J7 (ESSA project).
GenBankAL1615540.0AL161554.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 54.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867865.11e-134hypothetical protein ARALYDRAFT_492780, partial
SwissprotQ9SUB04e-97DOF43_ARATH; Dof zinc finger protein DOF4.3
TrEMBLD7MFF51e-134D7MFF5_ARALL; Putative uncharacterized protein (Fragment)
STRINGfgenesh2_kg.7__2213__AT4G21080.11e-134(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21040.12e-97Dof-type zinc finger domain-containing protein